CDS

Accession Number TCMCG063C17545
gbkey CDS
Protein Id KAF7817908.1
Location complement(1287644..1287994)
Organism Senna tora
locus_tag G2W53_023363

Protein

Length 116aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA605066, BioSample:SAMN14013601
db_source JAAIUW010000008.1
Definition eukaryotic translation initiation factor 3 subunit A-like [Senna tora]
Locus_tag G2W53_023363

EGGNOG-MAPPER Annotation

COG_category J
Description RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko03012        [VIEW IN KEGG]
KEGG_ko ko:K03254        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03013        [VIEW IN KEGG]
map03013        [VIEW IN KEGG]
GOs GO:0001732        [VIEW IN EMBL-EBI]
GO:0002181        [VIEW IN EMBL-EBI]
GO:0002183        [VIEW IN EMBL-EBI]
GO:0002188        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003723        [VIEW IN EMBL-EBI]
GO:0003729        [VIEW IN EMBL-EBI]
GO:0003743        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0005852        [VIEW IN EMBL-EBI]
GO:0005886        [VIEW IN EMBL-EBI]
GO:0006412        [VIEW IN EMBL-EBI]
GO:0006413        [VIEW IN EMBL-EBI]
GO:0006518        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008135        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009059        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0022607        [VIEW IN EMBL-EBI]
GO:0022613        [VIEW IN EMBL-EBI]
GO:0022618        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0034622        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0034645        [VIEW IN EMBL-EBI]
GO:0043043        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043603        [VIEW IN EMBL-EBI]
GO:0043604        [VIEW IN EMBL-EBI]
GO:0043614        [VIEW IN EMBL-EBI]
GO:0043933        [VIEW IN EMBL-EBI]
GO:0044085        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044271        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0065003        [VIEW IN EMBL-EBI]
GO:0071540        [VIEW IN EMBL-EBI]
GO:0071541        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071826        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0071944        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901566        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]
GO:1990904        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGGCTCATTCGGTATCAAATCATATTTCATGCATCTGTCAACTGAACAAGCTCGCAGCCAGGCACAAGCATTAGAAGAGGCTCTTGATGTTGATGATTTAGAGGCAGATAAAAGGCCAGAGGACTTGATGCTAAGCTATGTAAGTGGGGAGAAACGAAAAGACAGATCTGATCGGGAGCTTGTGACTCCATGGGTCAATTTCTTATGGGAAATATACAGGACAGTTCTTGAGATATTACGGAACAATTCAAAATTGGAGGCCCTATTATGCTGTAAGCTATTATTTTATTTTATTTTTCCCCTCTGTCATACTTTTATTTTATATTATTTCCTGGGATATGCGTTCTGA
Protein:  
MGSFGIKSYFMHLSTEQARSQAQALEEALDVDDLEADKRPEDLMLSYVSGEKRKDRSDRELVTPWVNFLWEIYRTVLEILRNNSKLEALLCCKLLFYFIFPLCHTFILYYFLGYAF